Iright
BRAND / VENDOR: Proteintech

Proteintech, 10489-1-AP, S100A14 Polyclonal antibody

CATALOG NUMBER: 10489-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The S100A14 (10489-1-AP) by Proteintech is a Polyclonal antibody targeting S100A14 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, rat samples 10489-1-AP targets S100A14 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, rat samples. Tested Applications Positive WB detected in: MCF-7 cells, rat stomach tissue Positive IP detected in: MCF-7 cells Positive IHC detected in: human colon cancer tissue, human skin tissue, human ovary tumor tissue, human breast cancer tissue, human bowen disease, human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information The S100 family is a multifunctional group of EF-hand type calciumbinding proteins. S100A14 protein (previously known as BCMP84, S100A15) is a recently identified member of the S100 family. It is differentially expressed in a number of different human malignancies like ovary, breast, uterus, kidney, rectum and colon cancers, and esophageal and oral squamous cell carcinomas (OSCCs). Specification Tested Reactivity: human, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0757 Product name: Recombinant human S100A14 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-104 aa of BC005019 Sequence: MGQCRSANAEDAQEFSDVERAIETLIKNFHQYSVEGGKETLTPSELRDLVTQQLPHLMPSNCGLEEKIANLGSCNDSKLEFRSFWELIGEAAKSVKLERPVRGH Predict reactive species Full Name: S100 calcium binding protein A14 Calculated Molecular Weight: 12 kDa Observed Molecular Weight: 10-12 kDa GenBank Accession Number: BC005019 Gene Symbol: S100A14 Gene ID (NCBI): 57402 RRID: AB_2183628 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9HCY8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924