Proteintech, 10512-1-AP, PLEKHB1 Polyclonal antibody

Size: 20ul / 150ul The PLEKHB1 (10512-1-AP) by Proteintech is a Polyclonal antibody targeting PLEKHB1 in WB, ELISA applications with reactivity to human, mouse, rat samples 10512-1-AP targets PLEKHB1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: SH-SY5Y cells Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Background Information PLEKHB1, also named as Evectin-1, EVT1, KPL1, PHR1 and PHRET1, is required for proper localization of retinogeniculate projections but not for eye-specific segregation. PLEKHB1 has 4 isoforms with MW from 21-27kd. It has Dimer form with MW 42-54 kDa. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0797 Product name: Recombinant human PLEKHB1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 17-189 aa of BC008075 Sequence: RRWKRNWFALWLDGTLGYYHDETAQDEEDRVLIHFNVRDIKIGPECHDVQPPEGRSRDGLLTVNLREGGRLHLCAETKDDALAWKTALLEANSTPVRVYSPYQDYYEVVPPNAHEATYVRSYYGPPYAGPGVTHVIVREDPCYSAGAPLAMGMLAGAATGAALGSLMWSPCWF Predict reactive species Full Name: pleckstrin homology domain containing, family B (evectins) member 1 Calculated Molecular Weight: 21 kDa Observed Molecular Weight: 50 kDa GenBank Accession Number: BC008075 Gene Symbol: PLEKHB1 Gene ID (NCBI): 58473 RRID: AB_2166943 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UF11 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.