Proteintech, 10522-1-AP, IFNAR2 Polyclonal antibody

Size: 20ul / 150ul The IFNAR2 (10522-1-AP) by Proteintech is a Polyclonal antibody targeting IFNAR2 in WB, FC (Intra), ELISA applications with reactivity to human samples 10522-1-AP targets IFNAR2 in WB, IF, FC (Intra), IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, K-562 cells, MCF-7 cells Positive FC (Intra) detected in: MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension Specification Tested Reactivity: human Cited Reactivity: human, pig Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0191 Product name: Recombinant human IFNAR2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 230-331 aa of BC002793 Sequence: LPPGQESESAESAKIGGIITVFLIALVLTSTIVTLKWIGYICLRNSLPKVLRQGLTKGWNAVAIHRCSHNALQSETPELKQSSCLSFPSSWDYKRASLCPSD Predict reactive species Full Name: interferon (alpha, beta and omega) receptor 2 Calculated Molecular Weight: 331 aa, 37 kDa Observed Molecular Weight: 58-70 kDa GenBank Accession Number: BC002793 Gene Symbol: IFNAR2 Gene ID (NCBI): 3455 RRID: AB_10694421 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P48551 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.