Iright
BRAND / VENDOR: Proteintech

Proteintech, 10544-1-AP, TAF9 Polyclonal antibody

CATALOG NUMBER: 10544-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The TAF9 (10544-1-AP) by Proteintech is a Polyclonal antibody targeting TAF9 in WB, IP, ELISA applications with reactivity to human, mouse, rat samples 10544-1-AP targets TAF9 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, MCF-7 cells, human colon tissue, human skeletal muscle tissue, HEK-293 cells, human heart tissue, rat liver tissue Positive IP detected in: mouse skeletal muscle tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information TAF9, also named as TAF2G, TAFII31, is a 264 amino acid protein, which belongs to the TAF9 family. TAF9 are involved in transcriptional activation as well as repression of distinct but overlapping sets of genes. TAF9 may have a role in gene regulation associated with apoptosis. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0833 Product name: Recombinant human TAF9 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-172 aa of BC007426 Sequence: MLLPNILLTGTPGVGKTTLGKELASKSGLKYINVGDLAREEQLYDGYDEEYDCPILDEDRVVDELDNQMREGGVIVDYHGCDFFPERWFHIVFVLRTDTNVLYERLETRGYNEKKLTDNIQCEIFQVLYEEATASYKEEIVHQLPSNKPEELENNVDQILKWIEQWIKDHNS Predict reactive species Full Name: TAF9 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 32kDa Calculated Molecular Weight: 28 kDa Observed Molecular Weight: 24-28 kDa GenBank Accession Number: BC007426 Gene Symbol: TAF9 Gene ID (NCBI): 6880 RRID: AB_2271416 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q16594 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924