Proteintech, 10564-1-AP, APOL4 Polyclonal antibody

Size: 20ul / 150ul The APOL4 (10564-1-AP) by Proteintech is a Polyclonal antibody targeting APOL4 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human samples 10564-1-AP targets APOL4 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HepG2 cells, U-87 MG cells Positive IP detected in: HepG2 cells Positive IHC detected in: human liver cancer tissue, human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0849 Product name: Recombinant human APOL4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-107 aa of BC006276 Sequence: MGSWVQLITSVGTSGLFLGVRVREEGAGMRCSKTIQAGQWLDSSKGPLGPSPPPVPTAGYSSSFCVHYVNLLPGVLVLSVTSQYPHLSMALCQLAAHDWPRLSCVCV Predict reactive species Full Name: apolipoprotein L, 4 Calculated Molecular Weight: 39 kDa Observed Molecular Weight: 40-50 kDa GenBank Accession Number: BC006276 Gene Symbol: APOL4 Gene ID (NCBI): 80832 RRID: AB_2242901 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9BPW4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.