Iright
BRAND / VENDOR: Proteintech

Proteintech, 10572-1-AP, MPZ / P0 Polyclonal antibody

CATALOG NUMBER: 10572-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The MPZ / P0 (10572-1-AP) by Proteintech is a Polyclonal antibody targeting MPZ / P0 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 10572-1-AP targets MPZ / P0 in WB, IHC, IF, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, mouse skeletal muscle tissue, rat brain tissue Positive IHC detected in: rat Ischiadic nerve tissue, mouse Ischiadic nerve tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information MPZ (myelin protein zero), also known as P0, is a transmembrane glycoprotein that belongs to the immunoglobulin supergene family. Synthesized by myelin-forming Schwann cells, MPZ is the major structural protein component of myelin in the peripheral nervous system. It is involved in the formation and maintenance of compact myelin and plays a role in the creation of an extracellular membrane face which guides the wrapping process and ultimately compacts adjacent lamellae. More than 120 mutations detected in the gene of MPZ cause various forms of hereditary neuropathy, which include Charcot-Marie-Tooth disease type 1B (CMT1B), CMT2, Dejerine-Sottas syndrome (DSS), and congenital hypomyelination neuropathy (CHN). This antibody can recognize endogenous MPZ and can be used as a marker of myelinating Schwann cells. MPZ can be detected the 25-30 kDa band by western blot. A band of 36 kDa could also be detected, which is a novel isoform of MPZ that contains an additional domain at the C-terminal (PMID: 22457349). It can also exist as a dimer (PMID: 12933931). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, frog Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0848 Product name: Recombinant human MPZ,P0 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-258 aa of BC006491 Sequence: MLRAPAPAPAMAPGAPSSSPSPILAVLLFSSLVLSPAQAIVVYTDREVHGAVGSRVTLHCSFWSSEWVSDDISFTWRYQPEGGRDAISIFHYAKGQPYIDEVGTFKERIQWVGDPRWKDGSIVIHNLDYSDNGTFTCDVKNPPDIVGKTSQVTLYVFEKVPTRYGVVLGAVIGGVLGVVLLLLLLFYVVRYCWLRRQAALQRRLSAMEKGKLHKPGKDASKRGRQTPVLYAMLDHSRSTKAVSEKKAKGLGESRKDKK Predict reactive species Full Name: myelin protein zero Calculated Molecular Weight: 28 kDa Observed Molecular Weight: 28-30 kDa GenBank Accession Number: BC006491 Gene Symbol: MPZ Gene ID (NCBI): 4359 RRID: AB_2144657 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P25189 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924