Proteintech, 10624-2-AP, FASN Polyclonal antibody

Size: 20ul / 150ul The FASN (10624-2-AP) by Proteintech is a Polyclonal antibody targeting FASN in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications with reactivity to human, mouse, rat samples 10624-2-AP targets FASN in WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293 cells, HeLa cells, HepG2 cells, SH-SY5Y cells, mouse liver tissue, rat liver tissue Positive IP detected in: mouse liver tissue Positive IHC detected in: human breast cancer tissue, mouse brain tissue, mouse brown adipose tissue, rat brown adipose tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Positive FC (Intra) detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension Background Information FASN gene codes for an enzyme essential for de novo fatty acid synthesis and cellular substrate energy metabolism. Active FASN is a homodimer in which each peptide subunit has a molecular weight of 260 kDa. FASN is overexpressed in various types of cancer including glioblastomas and is a potential therapeutic target. Recently FASN has been reported to contribute to the neurogenesis since FASN mutation caused intellectual disability in mice. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, pig, chicken, zebrafish, bovine, sheep, goat, duck Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0975 Product name: Recombinant human FASN protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 142-439 aa of BC007909 Sequence: QTQLNLRSLLVNPEGPTLMRLNSVQSSERPLFLVHPIEGSTTVFHSLASRLSIPTYGLQCTRAAPLDSIHSLAAYYIDCIRQVQPEGPYRVAGYSYGACVAFEMCSQLQAQQSPAPTHNSLFLFDGSPTYVLAYTQSYRAKLTPGCEAEAETEAICFFVQQFTDMEHNRVLEALLPLKGLEERVAAAVDLIIKSHQGLDRQELSFAARSFYYKLRAAEQYTPKAKYHGNVMLLRAKTGGAYGEDLGADYNLSQVCDGKVSVHVIEGDHRTLLEGSGLESIISIIHSSLAEPRVSVREG Predict reactive species Full Name: fatty acid synthase Calculated Molecular Weight: 272 kDa Observed Molecular Weight: 250-272 kDa GenBank Accession Number: BC007909 Gene Symbol: FASN Gene ID (NCBI): 2194 RRID: AB_2100801 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P49327 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.