Proteintech, 10647-1-AP, TOR3A Polyclonal antibody

Size: 20ul / 150ul The TOR3A (10647-1-AP) by Proteintech is a Polyclonal antibody targeting TOR3A in WB, IF/ICC, ELISA applications with reactivity to human, mouse samples 10647-1-AP targets TOR3A in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HEK-293 cells, HepG2 cells, Raji cells, PC-3 cells Positive IF/ICC detected in: HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:300-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1012 Product name: Recombinant human TOR3A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 97-397 aa of BC007571 Sequence: YLDLLTTWYCSFKDCCPRGDCRISNNFTGLEWDLNVRLHGQHLVQQLVLRTVRGYLETPQPEKALALSFHGWSGTGKNFVARMLVENLYRDGLMSDCVRMFIATFHFPHPKYVDLYKEQLMSQIRETQQLCHQTLFIFDEAEKLHPGLLEVLGPHLERRAPEGHRAESPWTIFLFLSNLRGDIINEVVLKLLKAGWSREEITMEHLEPHLQAEIVETIDNGFGHSRLVKENLIDYFIPFLPLEYRHVRLCARDAFLSQELLYKEETLDEIAQMMVYVPKEEQLFSSQGCKSISQRINYFLS Predict reactive species Full Name: torsin family 3, member A Calculated Molecular Weight: 46 kDa Observed Molecular Weight: 39-42 kDa, 46-52 kDa GenBank Accession Number: BC007571 Gene Symbol: TOR3A Gene ID (NCBI): 64222 RRID: AB_2303598 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9H497 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.