Proteintech, 10660-2-AP, HNRPDL Polyclonal antibody

Size: 20ul / 150ul The HNRPDL (10660-2-AP) by Proteintech is a Polyclonal antibody targeting HNRPDL in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 10660-2-AP targets HNRPDL in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HL-60 cells, HeLa cells, K-562 cells, mouse brain tissue, rat brain tissue Positive IHC detected in: human intrahepatic cholangiocarcinoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunohistochemistry (IHC): IHC : 1:400-1:1600 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1046 Product name: Recombinant human HNRPDL protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 132-415 aa of BC007392 Sequence: KINASKNQQDDGKMFIGGLSWDTSKKDLTEYLSRFGEVVDCTIKTDPVTGRSRGFGFVLFKDAASVDKVLELKEHKLDGKLIDPKRAKALKGKEPPKKVFVGGLSPDTSEEQIKEYFGAFGEIENIELPMDTKTNERRGFCFITYTDEEPVKKLLESRYHQIGSGKCEIKVAQPKEVYRQQQQQQKGGRGAAAGGRGGTRGRGRGQGQNWNQGFNNYYDQGYGNYNSAYGGDQNYSGYGGYDYTGYNYGNYGYGQGYADYSGQQSTYGKASRGGGNHQNNYQPY Predict reactive species Full Name: heterogeneous nuclear ribonucleoprotein D-like Calculated Molecular Weight: 46 aa, 4 kDa Observed Molecular Weight: 38-40 kDa GenBank Accession Number: BC007392 Gene Symbol: HNRPDL Gene ID (NCBI): 9987 RRID: AB_2120666 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O14979 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.