Iright
BRAND / VENDOR: Proteintech

Proteintech, 10681-1-AP, NUDC Polyclonal antibody

CATALOG NUMBER: 10681-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The NUDC (10681-1-AP) by Proteintech is a Polyclonal antibody targeting NUDC in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human samples 10681-1-AP targets NUDC in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HepG2 cells, HEK-293 cells, HeLa cells, K-562 cells, SH-SY5Y cells Positive IP detected in: HEK-293 cells Positive IHC detected in: human pancreas cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells, HEK-293 cells, HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Nuclear distribution protein C (NudC) is a highly conserved dynein/dynactin associated protein implicated in mitosis and cytokinesis. NudC is localized on major mitotic structures, and is involved in regulating spindle formation stability of kinetochore microtubule attachments, and chromosomes congression in early mitosis. NudC also is required for multi-protein transport along axons in neurons. Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0998 Product name: Recombinant human NUDC protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-331 aa of BC006147 Sequence: MGGEQEEERFDGMLLAMAQQHEGGVQELVNTFFSFLRRKTDFFIGGEEGMAEKLITQTFSHHNQLAQKTRREKRARQEAERREKAERAARLAKEAKSETSGPQIKELTDEEAERLQLEIDQKKDAENHEAQLKNGSLDSPGKQDTEEDEEEDEKDKGKLKPNLGNGADLPNYRWTQTLSELDLAVPFCVNFRLKGKDMVVDIQRRHLRVGLKGQPAIIDGELYNEVKVEESSWLIEDGKVVTVHLEKINKMEWWSRLVSSDPEINTKKINPENSKLSDLDSETRSMVEKMMYDQRQKSMGLPTSDEQKKQEILKKFMDQHPEMDFSKAKFN Predict reactive species Full Name: nuclear distribution gene C homolog (A. nidulans) Calculated Molecular Weight: 38 kDa Observed Molecular Weight: 42-45 kDa GenBank Accession Number: BC006147 Gene Symbol: NUDC Gene ID (NCBI): 10726 RRID: AB_2282933 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y266 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924