Iright
BRAND / VENDOR: Proteintech

Proteintech, 10683-1-AP, CDC23 Polyclonal antibody

CATALOG NUMBER: 10683-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CDC23 (10683-1-AP) by Proteintech is a Polyclonal antibody targeting CDC23 in WB, ELISA applications with reactivity to human, mouse, rat samples 10683-1-AP targets CDC23 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: MOLT-4 cells, HEK-293 cells, Jurkat cells, K-562 cells, Caco-2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Background Information CDC23(cell division cycle protein 23 homolog) is also named ANAPC8 and belongs to the APC8/CDC23 family. It is a subunit of the anaphase-promoting complex (APC), which functions at the metaphase-to-anaphase transition of the cell cycle and is regulated by spindle checkpoint proteins. It can be phosphorylated and the phosphorylation of Thr-562 occurs specifically during mitosis(PMID:19690332). It has 3 isoforms produced by alternative splicing with the molecular weight of 69 kDa, 17 kDa, and 56 kDa. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1068 Product name: Recombinant human CDC23 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-126 aa of BC005258 Sequence: MVPVAVTAAVAPVLSINSDFSDLREIKKQLLLIAGLTRERGLLHSSKWSAELAFSLPALPLAELQPPPPITEEDAQDMDAYTLAKAYFDVKEYDRAAHFLHGCNSKKAYFLYMYSRYLVRAILKCH Predict reactive species Full Name: cell division cycle 23 homolog (S. cerevisiae) Calculated Molecular Weight: 68 kDa Observed Molecular Weight: 69 kDa GenBank Accession Number: BC005258 Gene Symbol: CDC23 Gene ID (NCBI): 8697 RRID: AB_2075008 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UJX2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924