Proteintech, 10684-1-AP, ETV4 Polyclonal antibody

Size: 20ul / 150ul The ETV4 (10684-1-AP) by Proteintech is a Polyclonal antibody targeting ETV4 in WB, ELISA applications with reactivity to human samples 10684-1-AP targets ETV4 in WB, IHC, IF, ChIP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: BxPC-3 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information ETS translocation variant 4 (ETV4), also named as E1A-F or PEA3, is 484 amino acid protein, which contains one ETS DNA-binding domain and belongs to the ETS family. The calculated molecular weight of ETV4 protein is 54 kDa, but the phosphorylated ETV4 is a 54-61 kDa protein. ETV4 as a transcription activator localizes in the nucleus and binds to the enhancer of the adenovirus E1A gene. Specification Tested Reactivity: human Cited Reactivity: human, chicken Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0984 Product name: Recombinant human ETV4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-207 aa of BC007242 Sequence: MYLHTEGFSGPSPGDGAMGYGYEKPLRPFPDDVCVVPEKFEGDIKQEGVGAFREGPPYQRRGALQLWQFLVALLDDPTNAHFIAWTGRGMEFKLIEPEEVARLWGIQKNRPAMNYDKLSRSLRYYYEKGIMQKVAGERYVYKFVCEPEALFSLAFPDNQRPALKAEFDRPVSEEDTVPLSHLDESPAYLPELAGPAQPFGPKGGYSY Predict reactive species Full Name: ets variant 4 Calculated Molecular Weight: 54 kDa Observed Molecular Weight: 61-65 kDa GenBank Accession Number: BC007242 Gene Symbol: ETV4 Gene ID (NCBI): 2118 RRID: AB_2100984 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P43268 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.