Product Description
Size: 20ul / 150ul
The LSM5 (10700-1-AP) by Proteintech is a Polyclonal antibody targeting LSM5 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples
10700-1-AP targets LSM5 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.
Tested Applications
Positive WB detected in: HeLa cells, HL-60 cells, human brain tissue, human placenta tissue, mouse ovary tissue
Positive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Positive IF/ICC detected in: HeLa cells
Recommended dilution
Western Blot (WB): WB : 1:200-1:1000
Immunohistochemistry (IHC): IHC : 1:250-1:1000
Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500
Specification
Tested Reactivity: human, mouse
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag1145 Product name: Recombinant human LSM5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-91 aa of BC005938 Sequence: MAANATTNPSQLLPLELVDKCIGSRIHIVMKSDKEIVGTLLGFDDFVNMVLEDVTEFEITPEGRRITKLDQILLNGNNITMLVPGGEGPEV Predict reactive species
Full Name: LSM5 homolog, U6 small nuclear RNA associated (S. cerevisiae)
Calculated Molecular Weight: 10 kDa
Observed Molecular Weight: 10 kDa
GenBank Accession Number: BC005938
Gene Symbol: LSM5
Gene ID (NCBI): 23658
RRID: AB_2138475
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: Q9Y4Y9
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924