Proteintech, 10707-1-AP, CXCL11 Polyclonal antibody

Size: 20ul / 150ul The CXCL11 (10707-1-AP) by Proteintech is a Polyclonal antibody targeting CXCL11 in WB, IHC, ELISA applications with reactivity to human samples 10707-1-AP targets CXCL11 in WB, IHC, IF, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: IFN gamma, LPS and Brefeldin A treated THP-1 cells Positive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information CXCL11, also known as IFN-inducible T-cell α-chemoattractant (I-TAC), is a member of the ELR-negative CXC chemokine family. It is produced by various cells including leukocytes, fibroblasts, and endothelial cells upon stimulation with interferons (IFNs). CXCL11 signals through the chemokine receptors CXCR3 and CXCR7 . This chemokine is associated with multiple functions such as chemotactic migration, regulation of cell proliferation and self-renewal, increasing cell adhesion, and modulation of angiostatic effects. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1087 Product name: Recombinant human CXCL11 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-94 aa of BC005292 Sequence: MSVKGMAIALAVILCATVVQGFPMFKRGRCLCIGPGVKAVKVADIEKASIMYPSNNCDKIEVIITLKENKGQRCLNPKSKQARLIIKKVERKNF Predict reactive species Full Name: chemokine (C-X-C motif) ligand 11 Calculated Molecular Weight: 10 kDa Observed Molecular Weight: 10 kDa GenBank Accession Number: BC005292 Gene Symbol: CXCL11 Gene ID (NCBI): 6373 RRID: AB_2088022 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O14625 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.