Proteintech, 10708-1-AP, SAT1 Polyclonal antibody

Size: 20ul / 150ul The SAT1 (10708-1-AP) by Proteintech is a Polyclonal antibody targeting SAT1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 10708-1-AP targets SAT1 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293 cells Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Spermidine/spermine N1-acetyltransferase 1 (SAT1 or SSAT1) is the key regulatory enzyme in the catabolism of polyamines, catalyzing acetylation of spermidine or spermine to generate N1-acetyl spermidine or N1-acetyl spermine, and N1, N12-diacetylspermine. The cellular level of SAT1 is normally extremely low, but it is induced rapidly by a variety of stimuli, including polyamines, polyamine analogs, toxic chemicals, certain drugs, and growth factors. Downregulation of SAT1 has been reported in Epstein-Barr virus positive Burkitt's lymphoma cells. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1154 Product name: Recombinant human SAT1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-171 aa of BC008424 Sequence: MAKFVIRPATAADCSDILRLIKELAKYEYMEEQVILTEKDLLEDGFGEHPFYHCLVAEVPKEHWTPEGHSIVGFAMYYFTYDPWIGKLLYLEDFFVMSDYRGFGIGSEILKNLSQVAMRCRCSSMHFLVAEWNEPSINFYKRRGASDLSSEEGWRLFKIDKEYLLKMATEE Predict reactive species Full Name: spermidine/spermine N1-acetyltransferase 1 Calculated Molecular Weight: 20 kDa Observed Molecular Weight: 15-25 kDa GenBank Accession Number: BC008424 Gene Symbol: SAT1 Gene ID (NCBI): 6303 RRID: AB_2877739 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P21673 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.