Iright
BRAND / VENDOR: Proteintech

Proteintech, 10730-1-AP, AKR7A2 Polyclonal antibody

CATALOG NUMBER: 10730-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The AKR7A2 (10730-1-AP) by Proteintech is a Polyclonal antibody targeting AKR7A2 in WB, IHC, ELISA applications with reactivity to human, mouse samples 10730-1-AP targets AKR7A2 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse liver tissue, HepG2 cells, A431 cells, HEK-293 cells Positive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:100-1:400 Background Information AKR7A2(Aflatoxin B1 aldehyde reductase member 2) is also named as AFAR, AFAR1, AKR7 and belongs to the aldo/keto reductase family. AKR7A2 enzyme is catalytically active toward aldehydes arising from lipid peroxidation, suggesting a potential role against the consequences of oxidative stress, and representing an important detoxication route in mammalian cells (PMID:22001351). Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1049 Product name: Recombinant human AKR7A2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 60-359 aa of BC007352 Sequence: RAFLERGHTELDTAFMYSDGQSETILGGLGLGLGGGDCRVKIATKANPWDGKSLKPDSVRSQLETSLKRLQCPQVDLFYLHAPDHGTPVEETLHACQRLHQEGKFVELGLSNYASWEVAEICTLCKSNGWILPTVYQGMYNATTRQVETELFPCLRHFGLRFYAYNPLAGGLLTGKYKYEDKDGKQPVGRFFGNSWAETYRNRFWKEHHFEAIALVEKALQAAYGASAPSVTSAALRWMYHHSQLQGAHGDAVILGMSSLEQLEQNLAATEEGPLEPAVVDAFNQAWHLVAHECPNYFR Predict reactive species Full Name: aldo-keto reductase family 7, member A2 (aflatoxin aldehyde reductase) Calculated Molecular Weight: 40 kDa Observed Molecular Weight: 35-40 kDa GenBank Accession Number: BC007352 Gene Symbol: AKR7A2 Gene ID (NCBI): 8574 RRID: AB_2224439 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O43488 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924