Iright
BRAND / VENDOR: Proteintech

Proteintech, 10740-1-AP, RTN4/NOGO Polyclonal antibody

CATALOG NUMBER: 10740-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The RTN4/NOGO (10740-1-AP) by Proteintech is a Polyclonal antibody targeting RTN4/NOGO in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 10740-1-AP targets RTN4/NOGO in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, rat brain tissue Positive IHC detected in: mouse testis tissue, human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: A549 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Reticulon (RTN) proteins are a group of membrane-bound proteins that largely reside in endoplasmic reticulum (ER) (PMID: 18177508). Reticulon proteins share a common sequence feature, the reticulon homology domain (RHD). They are involved in shaping the tubular endoplasmic reticulum network, membrane trafficking, inhibition of axonal growth, and apoptosis (PMID: 24218324). Four mammalian reticulons (RTN1-4) exist. RTN4 (also known as Neurite outgrowth inhibitor or Nogo) is a myelin-associated neurite growth inhibitory protein. Some isoforms of RTN4 have been described. RTN4A (Nogo-A, runs at ~200 kDa), RTN4B (Nogo-B, 40-55 kDa), and RTN4C (Nogo-C, 22-25 kDa) are three major isoforms (PMID: 31092426; 16469703). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1164 Product name: Recombinant human RTN4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-199 aa of BC007109 Sequence: MDGQKKNWKDKVVDLLYWRDIKKTGVVFGASLFLLLSLTVFSIVSVTAYIALALLSVTISFRIYKGVIQAIQKSDEGHPFRAYLESEVAISEELVQKYSNSALGHVNCTIKELRRLFLVDDLVDSLKFAVLMWVFTYVGALFNGLTLLILALISLFSVPVIYERHQAQIDHYLGLANKNVKDAMAKIQAKIPGLKRKAE Predict reactive species Full Name: reticulon 4 Calculated Molecular Weight: 130 kDa Observed Molecular Weight: 190-210 kDa, 45 kDa, 22-25 kDa GenBank Accession Number: BC007109 Gene Symbol: NOGO Gene ID (NCBI): 57142 RRID: AB_2183598 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NQC3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924