Proteintech, 10761-1-AP, Secretogranin V Polyclonal antibody

Size: 20ul / 150ul The Secretogranin V (10761-1-AP) by Proteintech is a Polyclonal antibody targeting Secretogranin V in IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 10761-1-AP targets Secretogranin V in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive IHC detected in: rat pancreas tissue, human pituitary adenoma tissue, mouse pancreas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: PC-12 cells Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1107 Product name: Recombinant human SCG5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-212 aa of BC005349 Sequence: MVSRMVSTMLSGLLFWLASGWTPAFAYSPRTPDRVSEADIQRLLHGVMEQLGIARPRVEYPAHQAMNLVGPQSIEGGAHEGLQHLGPFGNIPNIVAELTGDNIPKDFSEDQGYPDPPNPCPVGKTADDGCLENTPDTAEFSREFQLHQHLSDPEHDYPGLGKWNKKLLYEKMKGGERRKRRSVNPYLQGQRLDNVVAKKSVPHFSDEDKDPE Predict reactive species Full Name: secretogranin V (7B2 protein) Calculated Molecular Weight: 24 kDa GenBank Accession Number: BC005349 Gene Symbol: Secretogranin V Gene ID (NCBI): 6447 RRID: AB_2183280 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P05408 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.