Proteintech, 10775-1-AP, BLVRA Polyclonal antibody

Size: 20ul / 150ul The BLVRA (10775-1-AP) by Proteintech is a Polyclonal antibody targeting BLVRA in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 10775-1-AP targets BLVRA in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HeLa cells, L02 cells, mouse liver tissue, HepG2 cells, HuH-7 cells, PC-3 cells, SH-SY5Y cells Positive IHC detected in: human prostate cancer tissue, human pancreas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: L02 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information BLVRA(Biliverdin reductase A) is also named as BLVR, BVR and belongs to the biliverdin reductase subfamily.It catalyze the conversion of biliverdin to bilirubin in the presence of NADPH or NADH.This protein can exsit as a dimer(PMID:11773068). Defects in BLVRA are the cause of hyperbiliverdinemia (HBLVD). Specification Tested Reactivity: human, mouse Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1166 Product name: Recombinant human BLVRA protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-296 aa of BC008456 Sequence: MNAEPERKFGVVVVGVGRAGSVRMRDLRNPHPSSAFLNLIGFVSRRELGSIDGVQQISLEDALSSQEVEVAYICSESSSHEDYIRQFLNAGKHVLVEYPMTLSLAAAQELWELAEQKGKVLHEEHVELLMEEFAFLKKEVVGKDLLKGSLLFTAGPLEEERFGFPAFSGISRLTWLVSLFGELSLVSATLEERKEDQYMKMTVCLETEKKSPLSWIEEKGPGLKRNRYLSFHFKSGSLENVPNVGVNKNIFLKDQNIFVQKLLGQFSEKELAAEKKRILHCLGLAEEIQKYCCSRK Predict reactive species Full Name: biliverdin reductase A Calculated Molecular Weight: 33.2 kDa Observed Molecular Weight: 37-40 kDa, 66 kDa GenBank Accession Number: BC008456 Gene Symbol: BLVRA Gene ID (NCBI): 644 RRID: AB_2065073 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P53004 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.