Iright
BRAND / VENDOR: Proteintech

Proteintech, 10778-1-AP, Adrenomedullin Polyclonal antibody

CATALOG NUMBER: 10778-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The Adrenomedullin (10778-1-AP) by Proteintech is a Polyclonal antibody targeting Adrenomedullin in IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 10778-1-AP targets Adrenomedullin in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive IHC detected in: human placenta tissue, human pancreas cancer tissue, human kidney tissue, mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: A549 cells Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Adrenomedullin (AM) and proadrenomedullin N-terminal 20 peptide (PAMP) are two small active hormones derived from the expression of a single gene (Adm) that is expressed throughout the GI tract, including the mucosal epithelium, glandular duct cells, neuroendocrine cells, and smooth muscle cells of the GI tract, between the oral cavity and the rectum (PMID:10782362, PMID:27345325). These two peptides coexist in GI cells, where they regulate many physiological functions including vasodilation, angiogenesis, anti-inflammation, organ protection, and tissue repair. AM suppresses inflammatory cytokine production in the intestinal mucosa, improves vascular and lymphatic function, mucosal epithelial repair, and intestinal barrier function in animal models with intestinal inflammation (PMID:27965594, PMID:29311984). Molecular mass species of 18, 14, and 6 kDa were identified in tumor cell lysates and presumably represent AM precursor, processed intermediates, and the authentic peptide, respectively. There is also a 22-kDa immunoreactive species in two cancer cell lines, H720 and MCF-7 (PMID: 8798536). Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1197 Product name: Recombinant human ADM protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-185 aa of BC015961 Sequence: MKLVSVALMYLGSLAFLGADTARLDVASEFRKKWNKWALSRGKRELRMSSSYPTGLADVKAGPAQTLIRPQDMKGASRSPEDSSPDAARIRVKRYRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGYGRRRRRSLPEAGPGRTLVSSKPQAHGAPAPPSGSAPHFL Predict reactive species Full Name: adrenomedullin Calculated Molecular Weight: 20 kDa GenBank Accession Number: BC015961 Gene Symbol: Adrenomedullin/ADM Gene ID (NCBI): 133 RRID: AB_2242255 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P35318 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924