Proteintech, 10800-1-AP, ARF3 Polyclonal antibody

Size: 20ul / 150ul The ARF3 (10800-1-AP) by Proteintech is a Polyclonal antibody targeting ARF3 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 10800-1-AP targets ARF3 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, HeLa cells, HepG2 cells, human brain tissue, mouse cerebellum tissue, Raji cells, rat brain tissue Positive IHC detected in: human kidney tissue, human pancreas tissue, human pancreas cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information ADP-ribosylation factors (ARFs) are members of the ARF family of GTP-binding proteins of the Ras superfamily, with 20kda protein size. ARFs bind and regulate GTP/GDP cycle by alternating between the active GTP-bound and inactive GDP-bound conformations. ARF family proteins are essential and ubiquitous in eukaryotes. Six highly conserved members of the family have been identified in mammalian cells. They function in vesicular traffic and actin remodelling and other bioprocesses in cells. ARF3 is 95% homolouous to ARF1. Its function was not fully understood. (PMID: 7759471, PMID: 16042562). This antibody can bind ARFs for the close sequences. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1174 Product name: Recombinant human ARF3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-181 aa of BC017565 Sequence: MGNIFGNLLKSLIGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLANQLKNKK Predict reactive species Full Name: ADP-ribosylation factor 3 Calculated Molecular Weight: 21 kDa Observed Molecular Weight: 18-20 kDa GenBank Accession Number: BC017565 Gene Symbol: ARF3 Gene ID (NCBI): 377 RRID: AB_2243128 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P61204 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.