Iright
BRAND / VENDOR: Proteintech

Proteintech, 10819-1-AP, KPNA2 Polyclonal antibody

CATALOG NUMBER: 10819-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The KPNA2 (10819-1-AP) by Proteintech is a Polyclonal antibody targeting KPNA2 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 10819-1-AP targets KPNA2 in WB, IHC, IF/ICC, IP, CoIP, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HepG2 cells, Jurkat cells, L02 cells, Raji cells, Ramos Positive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:20-1:400 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information KPNA2 (karyopherin α2) is a nuclear import factor involved in the nucleocytoplasmic transport system. It is functionally involved in the tumor progression and is elevated in multiple cancers. KPNA2 expression may be a useful prognostic biomarker to monitor cancer prognosis. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, pig Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1153 Product name: Recombinant human KPNA2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 230-529 aa of BC005978 Sequence: TWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAENLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLIEKYFSVEEEEDQNVVPETTSEGYTFQVQDGAPGTFNF Predict reactive species Full Name: karyopherin alpha 2 (RAG cohort 1, importin alpha 1) Calculated Molecular Weight: 57.8 kDa Observed Molecular Weight: 55-58 kDa GenBank Accession Number: BC005978 Gene Symbol: KPNA2 Gene ID (NCBI): 3838 RRID: AB_2265526 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P52292 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924