Proteintech, 10848-1-AP, HNRNPA0 Polyclonal antibody

Size: 20ul / 150ul The HNRNPA0 (10848-1-AP) by Proteintech is a Polyclonal antibody targeting HNRNPA0 in WB, IF/ICC, IP, ELISA applications with reactivity to human, mouse samples 10848-1-AP targets HNRNPA0 in WB, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HeLa cells, fetal human brain tissue, mouse brain tissue, Jurkat cells, NIH/3T3 cells Positive IP detected in: mouse brain tissue Positive IF/ICC detected in: A549 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Background Information HNRNPA0 belongs to the A/B subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). Two alternatively spliced transcript variants encoding different isoforms have been described for this gene. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1312 Product name: Recombinant human HNRNPA0 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-305 aa of BC019271 Sequence: MENSQLCKLFIGGLNVQTSESGLRGHFEAFGTLTDCVVVVNPQTKRSRCFGFVTYSNVEEADAAMAASPHAVDGNTVELKRAVSREDSARPGAHAKVKKLFVGGLKGDVAEGDLIEHFSQFGTVEKAEIIADKQSGKKRGFGFVYFQNHDAADKAAVVKFHPIQGHRVEVKKAVPKEDIYSGGGGGGSRSSRGGRGGRGRGGGRDQNGLSKGGGGGYNSYGGYGGGGGGGYNAYGGGGGGSSYGGSDYGNGFGGFGSYSQHQSSYGPMKSGGGGGGGGSSWGGRSNSGPYRGGYGGGGGYGGSSF Predict reactive species Full Name: heterogeneous nuclear ribonucleoprotein A0 Calculated Molecular Weight: 31 kDa Observed Molecular Weight: 31 kDa GenBank Accession Number: BC019271 Gene Symbol: HNRNPA0 Gene ID (NCBI): 10949 RRID: AB_2117066 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q13151 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.