Proteintech, 10860-1-AP, PKC Zeta Polyclonal antibody

Size: 20ul / 150ul The PKC Zeta (10860-1-AP) by Proteintech is a Polyclonal antibody targeting PKC Zeta in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 10860-1-AP targets PKC Zeta in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HEK-293 cells, NIH/3T3 cells Positive IHC detected in: human breast cancer tissue, mouse cerebellum tissue, mouse eye tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: NIH/3T3 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1310 Product name: Recombinant human PRKCZ protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 244-592 aa of BC014270 Sequence: SQGLGLQDFDLIRVIGRGSYAKVLLVRLKKNDQIYAMKVVKKELVHDDEDIDWVQTEKHVFEQASSNPFLVGLHSCFQTTSRLFLVIEYVNGGDLMFHMQRQRKLPEEHARFYAAEICIALNFLHERGIIYRDLKLDNVLLDADGHIKLTDYGMCKEGLGPGDTTSTFCGTPNYIAPEILRGEEYGFSVDWWALGVLMFEMMAGRSPFDIITDNPDMNTEDYLFQVILEKPIRIPRFLSVKASHVLKGFLNKDPKERLGCRPQTGFSDIKSHAFFRSIDWDLLEKKQALPPFQPQITDDYGLDNFDTQFTSEPVQLTPDDEDAIKRIDQSEFEGFEYINPLLLSTEESV Predict reactive species Full Name: protein kinase C, zeta Calculated Molecular Weight: 80 kDa Observed Molecular Weight: 68 kDa GenBank Accession Number: BC014270 Gene Symbol: PKC Zeta Gene ID (NCBI): 5590 RRID: AB_2300348 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q05513 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.