Iright
BRAND / VENDOR: Proteintech

Proteintech, 10880-1-AP, GAMT Polyclonal antibody

CATALOG NUMBER: 10880-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The GAMT (10880-1-AP) by Proteintech is a Polyclonal antibody targeting GAMT in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 10880-1-AP targets GAMT in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293 cells, mouse liver tissue, rat liver tissue, HepG2 cells, SH-SY5Y cells Positive IHC detected in: human liver tissue, human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:2000-1:16000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information GAMT converts the latter to creatine with S-adenosylmethionine as the methyl donor. GAMT was induced in human and mouse cells in response to genotoxic and metabolic stress. GAMT was required for p53-dependent upregulation of creatine biosynthesis, fatty acid oxidation, and apoptosis in response to glucose deprivation. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, zebrafish Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1327 Product name: Recombinant human GAMT protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-236 aa of BC016760 Sequence: MSAPSATPIFAPGENCSPAWGAAPAAYDAADTHLRILGKPVMERWETPYMHALAAAASSKGGRVLEVGFGMAIAASKVQEAPIDEHWIIECNDGVFQRLRDWAPRQTHKVIPLKGLWEDVAPTLPDGHFDGILYDTYPLSEETWHTHQFNFIKNHAFRLLKPGGVLTYCNLTSWGELMKSKYSDITIMFEETQVPALLEAGFRRENIRTEVMALVPPADCRYYAFPQMITPLVTKG Predict reactive species Full Name: guanidinoacetate N-methyltransferase Calculated Molecular Weight: 26 kDa Observed Molecular Weight: 26 kDa GenBank Accession Number: BC016760 Gene Symbol: GAMT Gene ID (NCBI): 2593 RRID: AB_2109304 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q14353 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924