Proteintech, 10882-1-AP, HAND1 Polyclonal antibody

Size: 20ul / 150ul The HAND1 (10882-1-AP) by Proteintech is a Polyclonal antibody targeting HAND1 in WB, ELISA applications with reactivity to human samples 10882-1-AP targets HAND1 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: SH-SY5Y cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information The HAND1 gene encodes a basic helix-loop-helix (bHLH) transcription factor essential for mammalian heart development (PMID:19586923). HAND1 is highly expressed in the heart and in cytotrophoblastic cell lines, and is required in the adult for sustained expression of cardiac-specific genes (PMID:9931445). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1324 Product name: Recombinant human HAND1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-215 aa of BC021190 Sequence: MNLVGSYAHHHHHHHPHPAHPMLHEPFLFGPASRCHQERPYFQSWLLSPADAAPDFPAGGPPPAAAAAATAYGPDARPGQSPGRLEALGGRLGRRKGSGPKKERRRTESINSAFAELRECIPNVPADTKLSKIKTLRLATSYIAYLMDVLAKDAQSGDPEAFKAELKKADGGRESKRKRELQQHEGFPPALGPVEKRIKGRTGWPQQVWALELNQ Predict reactive species Full Name: heart and neural crest derivatives expressed 1 Calculated Molecular Weight: 24 kDa Observed Molecular Weight: 24 kDa GenBank Accession Number: BC021190 Gene Symbol: HAND1 Gene ID (NCBI): 9421 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O96004 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.