Iright
BRAND / VENDOR: Proteintech

Proteintech, 10916-1-AP, SRp20 Polyclonal antibody

CATALOG NUMBER: 10916-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SRp20 (10916-1-AP) by Proteintech is a Polyclonal antibody targeting SRp20 in IHC, ELISA applications with reactivity to human, mouse samples 10916-1-AP targets SRp20 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive IHC detected in: human cervical cancer tissue, mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information SFRS3, also named as SRSF3 and SRP20, belongs to the splicing factor SR family. It may be involved in RNA processing in relation with cellular proliferation and/or maturation. SFRS3 is one of the cognate factors. It is a proto-oncogene critical for cell proliferation and tumor induction and maintenance.The MW of SFRS3 is 20kd. Specification Tested Reactivity: human, mouse Cited Reactivity: human, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1341 Product name: Recombinant human SRp20 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-164 aa of BC000914 Sequence: MHRDSCPLDCKVYVGNLGNNGNKTELERAFGYYGPLRSVWVARNPPGFAFVEFEDPRDAADAVRELDGRTLCGCRVRVELSNGEKRSRNRGPPPSWGRRPRDDYRRRSPPPRRRSPRRRSFSRSRSRSLSRDRRRERSLSRERNHKPSRSFSRSRSRSRSNERK Predict reactive species Full Name: splicing factor, arginine/serine-rich 3 Calculated Molecular Weight: 20 kDa GenBank Accession Number: BC000914 Gene Symbol: SRSF3 Gene ID (NCBI): 6428 RRID: AB_2185064 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P84103 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924