Proteintech, 10948-2-AP, SUB1 Polyclonal antibody

Size: 20ul / 150ul The SUB1 (10948-2-AP) by Proteintech is a Polyclonal antibody targeting SUB1 in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 10948-2-AP targets SUB1 in WB, IHC, IF/ICC, CoIP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, A549 cells Positive IHC detected in: human pancreas cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information SUB1 gene encodes activated RNA polymerase II transcriptional coactivator p15, also termed as positive cofactor 4 (PC4) or p14. SUB1 is a sort of general coactivator that functions in assembling and stablization of transcription complex. It has DNA binding activity and is localized in the nucleus, mulitple modification sites of phosphorylation or acetylation may turn it appear slightly shifted molecular weight. Catalog#10948-2-AP is a rabbit polyclonal antibody raised against full-length human SUB1. This antibody recognize 14-16 kDa (P14 or P15), 20 kDa(phospho form) and 30 kDa (Dimer form). Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1390 Product name: Recombinant human SUB1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-127 aa of BC009610 Sequence: MPKSKELVSSGSSGSDSDSEVDKKLKRKKQVAPEKPVKKQKTGETSRALSSSKQSSSSRDDNMFQIGKMRYVSVRDFKGKVLIDIREYWMDPEGEMKPGRKGISLNPEQWSQLKEQISDIDDAVRKL Predict reactive species Full Name: SUB1 homolog (S. cerevisiae) Calculated Molecular Weight: 14 kDa Observed Molecular Weight: 18-23 kDa GenBank Accession Number: BC009610 Gene Symbol: SUB1 Gene ID (NCBI): 10923 RRID: AB_2255452 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P53999 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.