Proteintech, 10949-2-AP, SLAM/CD150 Polyclonal antibody

Size: 20ul / 150ul The SLAM/CD150 (10949-2-AP) by Proteintech is a Polyclonal antibody targeting SLAM/CD150 in WB, ELISA applications with reactivity to human samples 10949-2-AP targets SLAM/CD150 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Jurkat cells Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Background Information Signaling lymphocytic activation molecule (SLAM, also known as SLAMF1 or CD150) is a 70-95 kDa transmembrane glycoprotein that belongs to the immunoglobulin gene superfamily. SLAM is constitutively expressed on peripheral blood memory T-cells, T-cell clones, immature thymocytes and a proportion of B-cells, and is rapidly induced on naive T-cells after activation. SLAM is involved in T cell stimulation and cytokine production, and may play an important role in the regulation of immune responses to pathogens. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1386 Product name: Recombinant human SLAMF1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-144 aa of BC012602 Sequence: MDPKGLLSLTFVLFLSLAFGASYGTGGRMMNCPKILRQLGSKVLLPLTYERINKSMNKSIHIVVTMAKSLENSVENKIVSLDPSEAGPPRYLGDRYKFYLENLTLGIRESRKEDEGWYLMTLEKSLHFGYLYFVLGADHDNLQT Predict reactive species Full Name: signaling lymphocytic activation molecule family member 1 Calculated Molecular Weight: 37 kDa Observed Molecular Weight: 70 kDa GenBank Accession Number: BC012602 Gene Symbol: CD150 Gene ID (NCBI): 6504 RRID: AB_2187822 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q13291 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.