Iright
BRAND / VENDOR: Proteintech

Proteintech, 10960-1-AP, Cofilin Polyclonal antibody

CATALOG NUMBER: 10960-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • ddddd

    99 xxxxxx

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The Cofilin (10960-1-AP) by Proteintech is a Polyclonal antibody targeting Cofilin in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 10960-1-AP targets Cofilin in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: MCF-7 cells, NIH/3T3 cells, human skin tissue, human brain tissue, mouse brain tissue, rat brain tissue, NCI-H1299 cells Positive IHC detected in: human colon tissue, human cervical cancer tissue, human heart tissue, human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: NIH/3T3 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:12000 Immunohistochemistry (IHC): IHC : 1:600-1:2400 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information Cofilin is a ubiquitous actin-binding protein required for the reorganization of actin filaments. It is a member of ADF (actin-depolymerizing factor)/cofilin family that is a key regulator of actin dynamics and essential for cellular motility, cytokinesis, and endocytosis. Cofilin activity is tightly regulated by phosphorylation and dephosphorylation.Phosphorylation at Ser3 can inhibit its activity, also causing translocation from the nucleus to the cytoplasm. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, monkey, chicken Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1399 Product name: Recombinant human Cofilin protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-166 aa of BC012318 Sequence: MASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKKNIILEEGKEILVGDVGQTVDDPYATFVKMLPDKDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKLTGIKHELQANCYEEVKDRCTLAEKLGGSAVISLEGKPL Predict reactive species Full Name: cofilin 1 (non-muscle) Calculated Molecular Weight: 18 kDa Observed Molecular Weight: 18-22 kDa GenBank Accession Number: BC012318 Gene Symbol: Cofilin Gene ID (NCBI): 1072 RRID: AB_2291830 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P23528 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924