Proteintech, 10965-1-AP, DCUN1D1 Polyclonal antibody

Size: 20ul / 150ul The DCUN1D1 (10965-1-AP) by Proteintech is a Polyclonal antibody targeting DCUN1D1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 10965-1-AP targets DCUN1D1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: Jurkat cells, mouse brain tissue, rat brain tissue Positive IHC detected in: human gliomas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:2000-1:12000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information It has been found that DCUN1D1, also known as squamous cell carcinoma-related oncogene, expression may play a role in development of brain metastasis in patients with Non-small cell lung carcinoma (NSCLC). DCUN1D1-positive tumor cells may have the ability to disrupt the blood-brain-barrier and colonize the brain. Those results suggest that DCUN1D1 may play a role in the brain parenchyma invasion. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1440 Product name: Recombinant human DCUN1D1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-259 aa of BC009478 Sequence: MNKLKSSQKDKVRQFMIFTQSSEKTAVSCLSQNDWKLDVATDNFFQNPELYIRESVKGSLDRKKLEQLYNRYKDPQDENKIGIDGIQQFCDDLALDPASISVLIIAWKFRAATQCEFSKQEFMDGMTELGCDSIEKLKAQIPKMEQELKEPGRFKDFYQFTFNFAKNPGQKGLDLEMAIAYWNLVLNGRFKFLDLWNKFLLEHHKRSIPKDTWNLLLDFSTMIADDMSNYDEEGAWPVLIDDFVEFARPQIAGTKSTTV Predict reactive species Full Name: DCN1, defective in cullin neddylation 1, domain containing 1 (S. cerevisiae) Calculated Molecular Weight: 30 kDa Observed Molecular Weight: 30 kDa GenBank Accession Number: BC009478 Gene Symbol: DCUN1D1 Gene ID (NCBI): 54165 RRID: AB_2088355 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96GG9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.