Iright
BRAND / VENDOR: Proteintech

Proteintech, 10984-1-AP, MRPS22 Polyclonal antibody

CATALOG NUMBER: 10984-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The MRPS22 (10984-1-AP) by Proteintech is a Polyclonal antibody targeting MRPS22 in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples 10984-1-AP targets MRPS22 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: Jurkat cells, rat spleen tissue, mouse liver tissue, mouse spleen tissue Positive IP detected in: Jurkat cells Positive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information MRPS22, also named as C3orf5, RPMS22 and S22mt, is a component of the mitochondrial ribosome small subunit (28S) which comprises a 12S rRNA and about 30 distinct proteins. Defects in MRPS22 are the cause of combined oxidative phosphorylation deficiency type 5 (COXPD5). MRPS22 is a 360-amino-acid protein that has been found in a limited number of species, having no ortholog in fungi or prokaryotes. The exact location of MRPS22 in the three dimensional structure of the ribosome and its exact function are currently unknown. Recently, a MRPS22 defect was shown to strongly hamper assembly of the small ribosomal subunit, whereas assembly of the large subunit and part of the small subunit were only mildly affected.(PMID:21189481) Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1421 Product name: Recombinant human MRPS22 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-360 aa of BC009296 Sequence: MAPLGTTVLLWSLLRSSPGVERVCFRARIQPWHGGLLQPLPCSFEMGLPRRRFSSEAAESGSPETKKPTFMDEEVQSILTKMTGLNLQKTFKPAIQELKPPTYKLMTQAQLEEATRQAVEAAKVRLKMPPVLEERVPINDVLAEDKILEGTETTKYVFTDISYSIPHRERFIVVREPSGTLRKASWEERDRMIQVYFPKEGRKILTPIIFKEENLRTMYSQDRHVDVLNLCFAQFEPDSTEYIKVHHKTYEDIDKRGKYDLLRSTRYFGGMVWYFVNNKKIDGLLIDQIQRDLIDDATNLVQLYHVLHPDGQSAQGAKDQAAEGINLIKVFAKTEAQKGAYIELTLQTYQEALSRHSAAS Predict reactive species Full Name: mitochondrial ribosomal protein S22 Calculated Molecular Weight: 41 kDa Observed Molecular Weight: 38 kDa GenBank Accession Number: BC009296 Gene Symbol: MRPS22 Gene ID (NCBI): 56945 RRID: AB_2146488 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P82650 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924