Proteintech, 11013-1-AP, SLC27A4/FATP4 Polyclonal antibody

Size: 20ul / 150ul The SLC27A4/FATP4 (11013-1-AP) by Proteintech is a Polyclonal antibody targeting SLC27A4/FATP4 in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples 11013-1-AP targets SLC27A4/FATP4 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HepG2 cells, mouse liver tissue, human colon tissue, human heart tissue, SMMC-7721 cells, mouse colon tissue, rat colon tissue, rat liver tissue Positive IP detected in: HepG2 cells Positive IHC detected in: human ovary tumor tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:300-1:1200 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, pig Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1490 Product name: Recombinant human SLC27A4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-237 aa of BC009959 Sequence: MPLTLSTLLQPGRIWTGRRAAEPTPGHNAAWSLSGGGAAVLQAGAETALDPGGILPVVPLLGIWRLALHPGLHQDHQAYLTGDVLVMDELGYLYFRDRTGDTFRWKGENVSTTEVEGTLSRLLDMADVAVYGVEVPGTEGRAGMAAVASPTGNCDLERFAQVLEKELPLYARPIFLRLLPELHKTGTYKFQKTELRKEGFDPAIVKDPLFYLDAQKGRYVPLDQEAYSRIQAGEEKL Predict reactive species Full Name: solute carrier family 27 (fatty acid transporter), member 4 Calculated Molecular Weight: 72 kDa Observed Molecular Weight: 70 kDa GenBank Accession Number: BC009959 Gene Symbol: FATP4/SLC27A4 Gene ID (NCBI): 10999 RRID: AB_2190637 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q6P1M0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.