Proteintech, 11015-2-AP, DOM3Z Polyclonal antibody

Size: 20ul / 150ul The DOM3Z (11015-2-AP) by Proteintech is a Polyclonal antibody targeting DOM3Z in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 11015-2-AP targets DOM3Z in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse testis tissue, SH-SY5Y cells Positive IP detected in: mouse testis tissue Positive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information DOM3Z also known as DXO, NG6, is a 396 amino acid ubiquitously expressed protein. This gene localizes to the major histocompatibility complex (MHC) class III region on chromosome 6 and possesses RNA 5'-pyrophosphohydrolase activity. Chromosome 6 contains 170 million base pairs and represents nearly 6% of the human genome. Partial deletion of the q arm of chromosome 6 is associated with early-onset colorectal cancer. DOM3Z is ubiquitously expressed, with high expression in the testis (PMID: 9799600). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1491 Product name: Recombinant human DOM3Z protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-396 aa of BC009344 Sequence: MDPRGTKRGAEKTEVAEPRNKLPRPAPSLPTDPALYSGPFPFYRRPSELGCFSLDAQRQYHGDARALRYYSPPPTNGPGPNFDLRDGYPDRYQPRDEEVQERLDHLLCWLLEHRGRLEGGPGWLAEAIVTWRGHLTKLLTTPYERQEGWQLAASRFQGTLYLSEVETPNARAQRLARPPLLRELMYMGYKFEQYMCADKPGSSPDPSGEVNTNVAFCSVLRSRLGSHPLLFSGEVDCTDPQAPSTQPPTCYVELKTSKEMHSPGQWRSFYRHKLLKWWAQSFLPGVPNVVAGFRNPDGFVSSLKTFPTMKMFEYVRNDRDGWNPSVCMNFCAAFLSFAQSTVVQDDPRLVHLFSWEPGGPVTVSVHQDAPYAFLPIWYVEAMTQDLPSPPKTPSPK Predict reactive species Full Name: dom-3 homolog Z (C. elegans) Calculated Molecular Weight: 43.6 kDa Observed Molecular Weight: 45 kDa GenBank Accession Number: BC009344 Gene Symbol: DOM3Z Gene ID (NCBI): 1797 RRID: AB_2095257 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O77932 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.