Proteintech, 11023-1-AP, ACTR1A/ACTR1B Polyclonal antibody

Size: 20ul / 150ul The ACTR1A/ACTR1B (11023-1-AP) by Proteintech is a Polyclonal antibody targeting ACTR1A/ACTR1B in WB, IHC, ELISA applications with reactivity to human, mouse samples 11023-1-AP targets ACTR1A/ACTR1B in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse brain tissue, mouse heart Positive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:300 Background Information ACTR1B (also known as beta centractin) is a part of the 20S dynactin complex. It colocalizes with centrosomes and vesicular (membranous) structures and is involved in cell division. ACTR1B and ACTR1A share 90% amino acid identity, and this antibody recognizes both ACTR1B and ACTR1A. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1467 Product name: Recombinant human ACTR1B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-376 aa of BC010090 Sequence: MESYDIIANQPVVIDNGSGVIKAGFAGDQIPKYCFPNYVGRPKHMRVMAGALEGDLFIGPKAEEHRGLLTIRYPMEHGVVRDWNDMERIWQYVYSKDQLQTFSEEHPVLLTEAPLNPSKNREKAAEVFFETFNVPALFISMQAVLSLYATGRTTGVVLDSGDGVTHAVPIYEGFAMPHSIMRVDIAGRDVSRYLRLLLRKEGVDFHTSAEFEVVRTIKERACYLSINPQKDEALETEKVQYTLPDGSTLDVGPARFRAPELLFQPDLVGDESEGLHEVVAFAIHKSDMDLRRTLFANIVLSGGSTLFKGFGDRLLSEVKKLAPKDIKIKISAPQERLYSTWIGGSILASLDTFKKMWVSKKEYEEDGSRAIHRKTF Predict reactive species Full Name: ARP1 actin-related protein 1 homolog B, centractin beta (yeast) Calculated Molecular Weight: 42 kDa Observed Molecular Weight: 42-50 kDa GenBank Accession Number: BC010090 Gene Symbol: ACTR1B Gene ID (NCBI): 10120 RRID: AB_2877742 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P42025 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.