Proteintech, 11032-1-AP, Alpha cardiac muscle actin Polyclonal antibody

Size: 20ul / 150ul The Alpha cardiac muscle actin (11032-1-AP) by Proteintech is a Polyclonal antibody targeting Alpha cardiac muscle actin in WB, IP, ELISA applications with reactivity to human, mouse, rat samples 11032-1-AP targets Alpha cardiac muscle actin in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse heart tissue, mouse skeletal muscle tissue, mouse thymus tissue Positive IP detected in: mouse heart tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1471 Product name: Recombinant human ACTC1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-377 aa of BC009978 Sequence: MCDDEETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFENEMATAASSSSLEKSYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYANNVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDEAGPSIVHRKCF Predict reactive species Full Name: actin, alpha, cardiac muscle 1 Calculated Molecular Weight: 377 aa, 42 kDa Observed Molecular Weight: 42 kDa GenBank Accession Number: BC009978 Gene Symbol: ACTC1 Gene ID (NCBI): 70 RRID: AB_2242376 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P68032 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.