Iright
BRAND / VENDOR: Proteintech

Proteintech, 11044-1-AP, SFRS7 Polyclonal antibody

CATALOG NUMBER: 11044-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SFRS7 (11044-1-AP) by Proteintech is a Polyclonal antibody targeting SFRS7 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 11044-1-AP targets SFRS7 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A549 cells, mouse testis tissue, rat testis tissue, HeLa cells, HepG2 cells, SKOV-3 cells Positive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information SFRS7 is a member of the serine/arginine (SR) splicing factor family, which mediated the alternative splicing events target the resulting mRNAs for degradation by means of an RNA surveillance pathway called nonsense-mediated mRNA decay. It was found to repress the splicing of MAPT/Tau exon 10 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1526 Product name: Recombinant human SFRS7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-238 aa of BC000997 Sequence: MSRYGRYGGETKVYVGNLGTGAGKGELERAFSYYGPLRTVWIARNPPGFAFVEFEDPRDAEDAVRGLDGKVICGSRVRVELSTGMPRRSRFDRPPARRPFDPNDRCYECGEKGHYAYDCHRYSRRRRSRSRSRSHSRSRGRRYSRSRSRSRGRRSRSASPRRSRSISLRRSRSASLRRSRSGSIKGSRYFQSPSRSRSRSRSISRPRSSRSKSRSPSPKRSRSPSGSPRRSASPERMD Predict reactive species Full Name: splicing factor, arginine/serine-rich 7, 35kDa Calculated Molecular Weight: 27 kDa Observed Molecular Weight: 35 kDa GenBank Accession Number: BC000997 Gene Symbol: SFRS7 Gene ID (NCBI): 6432 RRID: AB_2185229 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q16629 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924