Proteintech, 11045-2-AP, GNB5 Polyclonal antibody

Size: 20ul / 150ul The GNB5 (11045-2-AP) by Proteintech is a Polyclonal antibody targeting GNB5 in WB, IP, IHC, ELISA applications with reactivity to human, mouse, rat samples 11045-2-AP targets GNB5 in WB, IP, IF, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, human brain tissue Positive IP detected in: rat brain tissue Positive IHC detected in: human ovary tumor tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein-effector interaction. G proteins, which integrate signals between receptors and effector proteins, are composed of an alpha, a beta, and a gamma subunit. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1518 Product name: Recombinant human GNB5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-126 aa of BC011671 Sequence: MATEGLHENETLASLKSEAESLKGKLEEERAKLHDVELHQVAERVEALGQFVMKTRRTLKGHGNKVLCMDWCKDKRRIVSSSQDGKVIVWDSFTTNKVRHCSQPRYRGFRIPAYLKVLWSSCPALS Predict reactive species Full Name: guanine nucleotide binding protein (G protein), beta 5 Calculated Molecular Weight: 39 kDa Observed Molecular Weight: 39-42 kDa GenBank Accession Number: BC011671 Gene Symbol: GNB5 Gene ID (NCBI): 10681 RRID: AB_2109639 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O14775 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.