Proteintech, 11047-1-AP, UXT Polyclonal antibody

Size: 20ul / 150ul The UXT (11047-1-AP) by Proteintech is a Polyclonal antibody targeting UXT in WB, IP, ELISA applications with reactivity to human, mouse, rat samples 11047-1-AP targets UXT in WB, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, mouse brain tissue Positive IP detected in: mouse brain tissue Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information Ubiquitously expressed transcript (UXT) is a gene transcription regulator. It can regulate androgen receptor(AR) transcription by concerting with the coreperssor UR1. It is proposed a potential component of mitochondrial-associated LRPPRC, a multidomain organizer that potentially integrates mitochondria and the microtubular cytoskeleton with chromosome remodeling, for UXT increasing concentrations of UXT contributes to progressive aggregation of mitochondria and cell death potentially through its association with LRPPRC. UXT is possible a nuclear chaperone that promotes formation of the NF-kappa-B enhanceosome and which is essential for its nuclear function. It can suppresses cell transformation and mediate this function by interaction and inhibition of the biological activity of cell proliferation and survival stimulatory factors like MECOM Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1513 Product name: Recombinant human UXT protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-157 aa of BC008890 Sequence: MATPPKRRAVEATGEKVLRYETFISDVLQRDLRKVLDHRDKVYEQLAKYLQLRNVIERLQEAKHSELYMQVDLGCNFFVDTVVPDTSRIYVALGYGFFLELTLAEALKFIDRKSSLLTELSNSLTKDSMNIKAHIHMLLEGLRELQGLQNFPEKPHH Predict reactive species Full Name: ubiquitously-expressed transcript Calculated Molecular Weight: 20 kDa Observed Molecular Weight: 18 kDa, 45 kDa GenBank Accession Number: BC008890 Gene Symbol: UXT Gene ID (NCBI): 8409 RRID: AB_2241535 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UBK9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.