Iright
BRAND / VENDOR: Proteintech

Proteintech, 11076-1-AP, Oligophrenin 1 Polyclonal antibody

CATALOG NUMBER: 11076-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The Oligophrenin 1 (11076-1-AP) by Proteintech is a Polyclonal antibody targeting Oligophrenin 1 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse samples 11076-1-AP targets Oligophrenin 1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HeLa cells, mouse brain tissue Positive IP detected in: mouse brain tissue Positive IHC detected in: human cerebellum tissue, human retinoblastoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information The OPHN1 gene encodes a Rho-GTPase activating protein (RhoGAP), and mutations in OPHN1 are responsible for non-specific X-linked mental retardation (NSMR). OPHN1 is highly expressed in the brain and present both pre- and postsynaptically in neurons. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1536 Product name: Recombinant human OPHN1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 476-722 aa of BC059393 Sequence: DSSQCASIPYNGQGYPEPYVPEGGAYLPDREPFIVPVEPERTAEYEDDYGADEPEQQHPDHRRWRRALRPGPG Predict reactive species Full Name: oligophrenin 1 Calculated Molecular Weight: 802 aa, 92 kDa Observed Molecular Weight: 92 kDa GenBank Accession Number: BC059393 Gene Symbol: Oligophrenin 1 Gene ID (NCBI): 4983 RRID: AB_2158306 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O60890 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924