Proteintech, 11077-1-AP, RDH11 Polyclonal antibody

Size: 20ul / 150ul The RDH11 (11077-1-AP) by Proteintech is a Polyclonal antibody targeting RDH11 in IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 11077-1-AP targets RDH11 in IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive IHC detected in: human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HaCaT cells Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information RDH11(Retinol dehydrogenase 11) is also named as ARSDR1(androgen-regulated short-chain dehydrogenase/reductase 1 ), PSDR1(prostate short-chain dehydrogenase/reductase 1) and belongs to the short-chain dehydrogenases/reductases (SDR) family. RDH11 is involved in steroid synthesis and/or degradation in normal and neoplastic prostate epithelium, and, as such, it may be a key enzyme involved in maintaining intracellular balance of steroid hormones in these cells(PMID:11245473). The deduced protein contains 318 amino acids, and the transcript contains 2 potential polyadenylation signals. It has 2 isoforms produced by alternative splicing. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1485 Product name: Recombinant human RDH11 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 67-318 aa of BC011727 Sequence: RVYLACRDVEKGELVAKEIQTTTGNQQVLVRKLDLSDTKSIRAFAKGFLAEEKHLHVLINNAGVMMCPYSKTADGFEMHIGVNHLGHFLLTHLLLEKLKESAPSRIVNVSSLAHHLGRIHFHNLQGEKFYNAGLAYCHSKLANILFTQELARRLKGSGVTTYSVHPGTVQSELVRHSSFMRWMWWLFSFFIKTPQQGAQTSLHCALTEGLEILSGNHFSDCHVAWVSAQARNETIARRLWDVSCDLLGLPID Predict reactive species Full Name: retinol dehydrogenase 11 (all-trans/9-cis/11-cis) Calculated Molecular Weight: 35 kDa Observed Molecular Weight: 35 kDa GenBank Accession Number: BC011727 Gene Symbol: RDH11 Gene ID (NCBI): 51109 RRID: AB_2177870 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8TC12 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.