Iright
BRAND / VENDOR: Proteintech

Proteintech, 11090-1-AP, DNAJC7 Polyclonal antibody

CATALOG NUMBER: 11090-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The DNAJC7 (11090-1-AP) by Proteintech is a Polyclonal antibody targeting DNAJC7 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse samples 11090-1-AP targets DNAJC7 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: A549 cells, HEK-293 cells, Jurkat cells, moust testis Positive IP detected in: HEK-293 cells Positive IHC detected in: human pancreas cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information DnaJC7, otherwise referred to as Tpr2 or CCRP, is a conserved, type of J protein that is highly expressed within the brain. DnaJC7 has been found to modulate the flow of substrates from Hsp70 to Hsp90, providing a control mechanism in proteins such as glucocorticoids and progesterone receptor. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1572 Product name: Recombinant human DNAJC7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 145-494 aa of BC011837 Sequence: YEKIAETDFEKRDFRKVVFCMDRALEFAPACHRFKILKAECLAMLGRYPEAQSVASDILRMDSTNADALYVRGLCLYYEDCIEKAVQFFVQALRMAPDHEKACIACRNAKALKAKKEDGNKAFKEGNYKLAYELYTEALGIDPNNIKTNAKLYCNRGTVNSKLRKLDDAIEDCTNAVKLDDTYIKAYLRRAQCYMDTEQYEEAVRDYEKVYQTEKTKEHKQLLKNAQLELKKSKRKDYYKILGVDKNASEDEIKKAYRKRALMHHPDRHSGASAEVQKEEEKKFKEVGEAFTILSDPKKKTRYDSGQDLDEEGMNMGDFDPNNIFKAFFGGPGGFSFEASGPGNFFFQFG Predict reactive species Full Name: DnaJ (Hsp40) homolog, subfamily C, member 7 Calculated Molecular Weight: 56 kDa Observed Molecular Weight: 56 kDa GenBank Accession Number: BC011837 Gene Symbol: DNAJC7 Gene ID (NCBI): 7266 RRID: AB_2293179 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q99615 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924