Iright
BRAND / VENDOR: Proteintech

Proteintech, 11109-1-AP, ETFDH Polyclonal antibody

CATALOG NUMBER: 11109-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ETFDH (11109-1-AP) by Proteintech is a Polyclonal antibody targeting ETFDH in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples 11109-1-AP targets ETFDH in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, HEK-293 cells, rat brain tissue, mouse kidney tissue, mouse skeletal muscle tissue, rat kidney tissue Positive IP detected in: mouse brain tissue Positive IHC detected in: human liver cancer tissue, human liver tissue, human kidney tissue, human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information ETFDH(Electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial) is also named as ETF-QO and belongs to the ETF-QO/fixC family.It is a 64-kDa monomer integrated in the inner mitochondrial membrane, con- tains one molecule of FAD and a 4Fe4S cluster(PMID:12815589).Defects in ETFDH are the cause of glutaric aciduria type 2C (GA2C).This antibody is speicific to ETFDH. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1568 Product name: Recombinant human ETFDH protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 269-617 aa of BC011890 Sequence: QTYGIGLKELWVIDEKNWKPGRVDHTVGWPLDRHTYGGSFLYHLNEGEPLVALGLVVGLDYQNPYLSPFREFQRWKHHPSIRPTLEGGKRIAYGARALNEGGFQSIPKLTFPGGLLIGCSPGFMNVPKIKGTHTAMKSGILAAESIFNQLTSENLQSKTIGLHVTEYEDNLKNSWVWKELYSVRNIRPSCHGVLGVYGGMIYTGIFYWILRGMEPWTLKHKGSDFERLKPAKDCTPIEYPKPDGQISFDLLSSVALSGTNHEHDQPAHLTLRDDSIPVNRNLSIYDGPEQRFCPAGVYEFVPVEQGDGFRLQINAQNCVHCKTCDIKDPSQNINWVVPEGGGGPAYNGM Predict reactive species Full Name: electron-transferring-flavoprotein dehydrogenase Calculated Molecular Weight: 64 kDa Observed Molecular Weight: 64 kDa GenBank Accession Number: BC011890 Gene Symbol: ETFDH Gene ID (NCBI): 2110 RRID: AB_2231382 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q16134 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924