Iright
BRAND / VENDOR: Proteintech

Proteintech, 11126-1-AP, Rad51D Polyclonal antibody

CATALOG NUMBER: 11126-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The Rad51D (11126-1-AP) by Proteintech is a Polyclonal antibody targeting Rad51D in WB, IHC, ELISA applications with reactivity to human samples 11126-1-AP targets Rad51D in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells, HeLa cells, A2780 cells Positive IHC detected in: human lymphoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information RAD51L3, also named RAD51D, R51H3 and TRAD, belongs to the recA family and RAD51 subfamily. It is involved in the homologous recombination repair (HRR) pathway of double-stranded DNA breaks arising during DNA replication or induced by DNA-damaging agents. The BCDX2 complex binds single-stranded DNA, single-stranded gaps in duplex DNA, and specifically to nicks in duplex DNA. The Heterodimer of RAD51L3 is about 70 kDa. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1595 Product name: Recombinant human Rad51D protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-253 aa of BC014422 Sequence: MGVLRVGLCPGLTEEMIQLLRSHRIKTVVDLVSADLEEVAQKCGLSYKALVALRRVLLAQFSAFPVNGADLYEELKTSTAILSTGIGSLDKLLDAGLYTGEVTEIVGGPGSGKTQVCLCMAANVAHGLQQNVLYVDSNGGLTASRLLQLLQAKTQDEEEQAEALRRIQVVHAFDIFQMLDVLQELRGTVAQQVTGSSGTVKVVVVDSVTAVVSPLLGGQQREGLALMMQLARELKTLARDLGMAVVVTNHITR Predict reactive species Full Name: RAD51-like 3 (S. cerevisiae) Calculated Molecular Weight: 35 kDa Observed Molecular Weight: 30-40 kDa GenBank Accession Number: BC014422 Gene Symbol: Rad51D Gene ID (NCBI): 5892 RRID: AB_10644480 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O75771 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924