Iright
BRAND / VENDOR: Proteintech

Proteintech, 11151-1-AP, MYEOV Polyclonal antibody

CATALOG NUMBER: 11151-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The MYEOV (11151-1-AP) by Proteintech is a Polyclonal antibody targeting MYEOV in WB, IHC, ELISA applications with reactivity to human samples 11151-1-AP targets MYEOV in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: SGC-7901 cells, Jurkat cells Positive IHC detected in: human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information MYEOV, also named as OCIM, was originally isolated by the application of the NIH/3T3 tumorigenicity assay with DNA from a gastric carcinoma. It is a prognostic factor for patients with multiple myeloma, in part through a role of MYEOV in the control of MMC proliferation. MYEOV is a candidate oncogene activated in the amplification core located proximal toCCND1. The observed MW of this protein is 55 kDa(PMID: 20854874 ). Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1498 Product name: Recombinant human MYEOV protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-313 aa of BC011815 Sequence: MALRICVTYTPALPIGLCTRCCLCLEQSPSWCHCLRGVSFLTFHLHQSVPLGDRDSLLMFTRQAGHFVEGSKAGRSRGRLCLSQALRVAVRGAFVSLWFAAGAGDRERNKGDKGAQTGAGLSQEAEDVDVSRARRVTDAPQGTLCGTGNRNSGSQSARAVGVAHLGEAFRVGVEQAISSCPEEVHGRHGLSMEIMWARMDVALRSPGRGLLAGAGALCVTLAESSCPDYERGRRACLTLHRHPTPHCSTWGLPLRVAGSWLTVVTVEALGGWRMGVRRTGQVGPTMHPPPVSGASPLLLHHLLLLLLIIILTC Predict reactive species Full Name: myeloma overexpressed (in a subset of t(11;14) positive multiple myelomas) Calculated Molecular Weight: 33 kDa Observed Molecular Weight: 55-60 kDa GenBank Accession Number: BC011815 Gene Symbol: MYEOV Gene ID (NCBI): 26579 RRID: AB_671520 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96EZ4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924