Proteintech, 11155-1-AP, EIF5 Polyclonal antibody

Size: 20ul / 150ul The EIF5 (11155-1-AP) by Proteintech is a Polyclonal antibody targeting EIF5 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 11155-1-AP targets EIF5 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293 cells, HeLa cells, HepG2 cells, NIH/3T3 cells Positive IP detected in: HeLa cells Positive IHC detected in: human pancreas cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Eukaryotic translation initiation factor 5, also named as EIF5, is a 431 amino acid protein, which contains one W2 domain and belongs to the eIF-2-beta/eIF-5 family. EIF5 catalyzes the hydrolysis of GTP bound to the 40S ribosomal initiation complex with the subsequent joining of a 60S ribosomal subunit resulting in the release of eIF-2 and the guanine nucleotide. EIF5 plays multiple roles in translation initiation. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, hamster, goat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1629 Product name: Recombinant human EIF5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-307 aa of BC032866 Sequence: MSVNVNRSVSDQFYRYKMPRLIAKVEGKGNGIKTVIVNMVDVAKALNRPPTYPTKYFGCELGAQTQFDVKNDRYIVNGSHEANKLQDMLDGFIKKFVLCPECENPETDLHVNPKKQTIGNSCKACGYRGMLDTHHKLCTFILKNPPENSDSGTGKKEKEKKNRKGKDKENGSVSSSETPPPPPPPNEINPPPHTMEEEEDDDWGEDTTEEAQRRRMDEISDHAKVLTLSDDLERTIEERVNILFDFVKKKKEEGVIDSSDKEIVAEAERLDVKAMGPLVLTEVLFNEKIREQIKKYRRHFLRFCHNN Predict reactive species Full Name: eukaryotic translation initiation factor 5 Calculated Molecular Weight: 49 kDa Observed Molecular Weight: 50 kDa GenBank Accession Number: BC032866 Gene Symbol: EIF5 Gene ID (NCBI): 1983 RRID: AB_2877748 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P55010 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.