Iright
BRAND / VENDOR: Proteintech

Proteintech, 11158-1-AP, ABCB7 Polyclonal antibody

CATALOG NUMBER: 11158-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ABCB7 (11158-1-AP) by Proteintech is a Polyclonal antibody targeting ABCB7 in WB, IP, ELISA applications with reactivity to human, mouse, rat samples 11158-1-AP targets ABCB7 in WB, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse liver tissue, mouse thymus tissue Positive IP detected in: mouse liver tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information ABCB7 belongs to the ATP-binding cassette (ABC) transporter superfamily. ABCB7 exports glutathione-coordinated iron-sulfur clusters from the mitochondria to the cytosol in an ATP-dependent manner allowing the assembly of the cytosolic iron-sulfur-containing proteins and participates in iron homeostasis(PMID: 33157103, 17192393). ABCB7 structure and mutation causing X- linked sideroblastic anemia and ataxia (XLSA/A) with disruption of cytosolic iron-sulfur protein maturation (PMID: 10196363,11050011). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1544 Product name: Recombinant human ABCB7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 25-173 aa of BC006323 Sequence: AILIRPLVSVSGSGPQWRPHQLGALGTARAYQQIPESLKSITWQRLGKGNSGQFLDAAKALQVWPLIEKRTCWHGHAGGGLHTDPKEGLKDVDTRKIIKAMLSYVWPKDRPDLRARVAISLGFLGGAKAMNIVVPFMFKYAVDSLNQMS Predict reactive species Full Name: ATP-binding cassette, sub-family B (MDR/TAP), member 7 Calculated Molecular Weight: 753 aa, 83 kDa Observed Molecular Weight: 83 kDa GenBank Accession Number: BC006323 Gene Symbol: ABCB7 Gene ID (NCBI): 22 RRID: AB_2220945 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O75027 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924