Iright
BRAND / VENDOR: Proteintech

Proteintech, 11166-2-AP, IDI1 Polyclonal antibody

CATALOG NUMBER: 11166-2-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The IDI1 (11166-2-AP) by Proteintech is a Polyclonal antibody targeting IDI1 in WB, IP, IHC, ELISA applications with reactivity to human, mouse, rat samples 11166-2-AP targets IDI1 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: L02 cells, human liver tissue, mouse liver tissue Positive IP detected in: mouse liver tissue Positive IHC detected in: human prostate cancer tissue, human colon cancer tissue, human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:3000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:4000-1:16000 Background Information IDI1(Isopentenyl-diphosphate Delta-isomerase 1) is a peroxisomally-localized enzyme that catalyzes the interconversion of isopentenyl diphosphate (IPP) to its highly electrophilic isomer, dimethylallyl diphosphate (DMAPP). It belongs to the IPP isomerase type 1 family. This protein has 2 isoforms produced by alternative splicing with the molecular weight of 26 kDa and 32 kDa. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1636 Product name: Recombinant human IDI1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-237 aa of BC019227 Sequence: VLEQIRHFVMMPEINTNHLDKQQVQLLAEMCILIDENDNKIGAETKKNCHLNENIEKGLLHRAFSVFLFNTENKLLLQQRSDAKITFPGCFTNTCCSHPLSNPAELEESDTLGVRRAAQRRLKAELGIPLEEVPPEEINYLTRIHYKAQSDGIWGEHEIDYILLVRKNVTLNPDPNEIKSYCYVSKEELKELLKKAASGEIKITPWFKIIAATFLFKWWDNLNHLNQFVDHEKIYRM Predict reactive species Full Name: isopentenyl-diphosphate delta isomerase 1 Calculated Molecular Weight: 31 kDa Observed Molecular Weight: 28 kDa GenBank Accession Number: BC019227 Gene Symbol: IDI1 Gene ID (NCBI): 3422 RRID: AB_2233532 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q13907 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924