Proteintech, 11173-1-AP, FKBP8 Polyclonal antibody

Size: 20ul / 150ul The FKBP8 (11173-1-AP) by Proteintech is a Polyclonal antibody targeting FKBP8 in WB, IF/ICC, IP, ELISA applications with reactivity to human, mouse samples 11173-1-AP targets FKBP8 in WB, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HEK-293 cells, mouse liver tissue, SH-SY5Y cells, mouse brain tissue, mouse pancreas tissue, Jurkat cells, HeLa cells Positive IP detected in: HeLa cells Positive IF/ICC detected in: A431 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information FK506 binding protein 8 (FKBP8), is a member of the immunophilin protein family, which plays a role in immunoregulation and basic cellular processes involving protein folding and trafficking. FKBP8 does not seem to have PPIase/rotamase activity, which is different from other members of this family. The active form of FKBP8 may play a role in the regulation of apoptosis. FKBP8 has 3 isoforms produced by alternative splicing. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1649 Product name: Recombinant human FKBP8 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-355 aa of BC009966 Sequence: MGQPPAEEAEQPGALAREFLAAMEPEPAPAPAPEEWLDILGNGLLRKKTLVPGPPGSSRPVKGQVVTVHLQTSLENGTRVQEEPELVFTLGDCDVIQALDLSVPLMDVGETAMVTADSKYCYGPQGRSPYIPPHAALCLEVTLKTAVDGPDLEMLTGQERVALANRKRECGNAHYQRADFVLAANSYDLAIKAITSSAKVDMTFEEEAQLLQLKVKCLNNLAASQLKLDHYRAALRSCSLVLEHQPDNIKALFRKGKVLAQQGEYSEAIPILRAALKLEPSNKTIHAELSKLVKKHAAQRSTETALYRKMLGNPSRLPAKCPGKGAWSIPWKWLFGATAVALGGVALSVVIAARN Predict reactive species Full Name: FK506 binding protein 8, 38kDa Calculated Molecular Weight: 45 kDa Observed Molecular Weight: 53 kDa GenBank Accession Number: BC009966 Gene Symbol: FKBP8 Gene ID (NCBI): 23770 RRID: AB_10597097 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q14318 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.