Proteintech, 11175-1-AP, PSMA1 Polyclonal antibody

Size: 20ul / 150ul The PSMA1 (11175-1-AP) by Proteintech is a Polyclonal antibody targeting PSMA1 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 11175-1-AP targets PSMA1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: COLO 320 cells, HeLa cells, PC-3 cells, mouse kidney tissue Positive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: PC-3 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information PSMA1(Proteasome subunit alpha type-1) is also named as HC2, NU, PROS30, PSC2 and belongs to the peptidase T1A family.The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH.It is induced in breast cancer tissue and up-regulated in liver tumor tissues(PMID:17127214;16317774;17004105). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1660 Product name: Recombinant human PSMA1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-263 aa of BC015105 Sequence: MFRNQYDNDVTVWSPQGRIHQIEYAMEAVKQGSATVGLKSKTHAVLVALKRAQSELAAHQKKILHVDNHIGISIAGLTADARLLCNFMRQECLDSRFVFDRPLPVSRLVSLIGSKTQIPTQRYGRRPYGVGLLIAGYDDMGPHIFQTCPSANYFDCRAMSIGARSQSARTYLERHMSEFMECNLNELVKHGLRALRETLPAEQDLTTKNVSIGIVGKDLEFTIYDDDDVSPFLEGLEERPQRKAQPAQPADEPAEKADEPMEH Predict reactive species Full Name: proteasome (prosome, macropain) subunit, alpha type, 1 Calculated Molecular Weight: 30 kDa Observed Molecular Weight: 29-33 kDa GenBank Accession Number: BC015105 Gene Symbol: PSMA1 Gene ID (NCBI): 5682 RRID: AB_2171377 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P25786 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.